PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400002482
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family MIKC_MADS
Protein Properties Length: 177aa    MW: 20678.6 Da    PI: 9.984
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400002482genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF89.22.2e-28959151
                          S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                          krienk+ rqvtfskRr g+lKKA+E+SvLCda+va+i+fs++gkl+ yss
  PGSC0003DMP400002482  9 KRIENKISRQVTFSKRRSGLLKKANEISVLCDADVALIVFSTKGKLFQYSS 59
                          79***********************************************96 PP

2K-box1059e-3576173198
                 K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqe 89 
                           y++++ +++++   e+++ e+ kL ++ie Lqr++Rh++G+dL++Lsl+eLq++eqq+++slk+iRs+Kn+l++e+i+elqkke++lqe
  PGSC0003DMP400002482  76 YAETQMNANDSDPKENWSVEYPKLMSRIELLQRNIRHYMGQDLDPLSLRELQSIEQQIDTSLKRIRSRKNQLMHESISELQKKERALQE 164
                           56677777888889*************************************************************************** PP

                 K-box  90 enkaLrkkl 98 
                           +n+ ++kk+
  PGSC0003DMP400002482 165 QNNLITKKV 173
                           ***999986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.6E-38160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.567161IPR002100Transcription factor, MADS-box
CDDcd002652.10E-38277No hitNo description
SuperFamilySSF554556.93E-33291IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-30323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003192.3E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-303859IPR002100Transcription factor, MADS-box
PfamPF014861.2E-2985173IPR002487Transcription factor, K-box
PROSITE profilePS5129715.85189176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MGRGRVELKR IENKISRQVT FSKRRSGLLK KANEISVLCD ADVALIVFST KGKLFQYSST  60
DSSMESILER YERYSYAETQ MNANDSDPKE NWSVEYPKLM SRIELLQRNI RHYMGQDLDP  120
LSLRELQSIE QQIDTSLKRI RSRKNQLMHE SISELQKKER ALQEQNNLIT KKVYIS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P8e-22175173Myocyte-specific enhancer factor 2B
1tqe_Q8e-22175173Myocyte-specific enhancer factor 2B
1tqe_R8e-22175173Myocyte-specific enhancer factor 2B
1tqe_S8e-22175173Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0131260.0BT013126.1 Lycopersicon esculentum clone 114416F, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006338337.11e-122PREDICTED: truncated transcription factor CAULIFLOWER A
SwissprotQ412763e-87AP1_SINAL; Floral homeotic protein APETALA 1
TrEMBLM0ZLS11e-126M0ZLS1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000034851e-122(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.13e-88MIKC_MADS family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]